Showing tool doc from version 4.6.2.0 | The latest version is
4.6.2.0

**BETA** AnalyzeSaturationMutagenesis

(EXPERIMENTAL) Processes reads from a MITESeq or other saturation mutagenesis experiment.

Category Coverage Analysis


Overview

Process reads from a saturation mutagenesis experiment.

This tool processes reads from an experiment that systematically perturbs a mini-gene to ascertain which amino-acid variations are tolerable at each codon of the open reading frame. It's main job is to discover variations from wild-type sequence among the reads, and to summarize the variations observed.

Input

Output

Usage example

     gatk AnalyzeSaturationMutagenesis \
     -I input_reads.bam \
     -R referenceGene.fasta \
     --orf 128-1285 \
     -O /path/to/output/and/reportNamePrefix
 

Additional Information

Read filters

This Read Filter is automatically applied to the data by the Engine before processing by AnalyzeSaturationMutagenesis.

AnalyzeSaturationMutagenesis specific arguments

This table summarizes the command-line arguments that are specific to this tool. For more details on each argument, see the list further down below the table or click on an argument name to jump directly to that entry in the list.

Argument name(s) Default value Summary
Required Arguments
--input
 -I
BAM/SAM/CRAM file containing reads
--orf
reference interval(s) of the ORF (1-based, inclusive), for example, '134-180,214-238' (no spaces)
--output-file-prefix
 -O
output file prefix
--reference
 -R
Reference sequence file
Optional Tool Arguments
--arguments_file
read one or more arguments files and add them to the command line
--cloud-index-prefetch-buffer
 -CIPB
-1 Size of the cloud-only prefetch buffer (in MB; 0 to disable). Defaults to cloudPrefetchBuffer if unset.
--cloud-prefetch-buffer
 -CPB
40 Size of the cloud-only prefetch buffer (in MB; 0 to disable).
--codon-translation
KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVVXYXYSSSSXCWCLFLF codon translation (a string of 64 amino acid codes
--disable-bam-index-caching
 -DBIC
false If true, don't cache bam indexes, this will reduce memory requirements but may harm performance if many intervals are specified. Caching is automatically disabled if there are no intervals specified.
--disable-sequence-dictionary-validation
false If specified, do not check the sequence dictionaries from our inputs for compatibility. Use at your own risk!
--dont-ignore-disjoint-pairs
false don't discard disjoint mates (i.e., combine variants from both reads)
--find-large-deletions
false examine supplemental alignments to find large deletions
--gcs-max-retries
 -gcs-retries
20 If the GCS bucket channel errors out, how many times it will attempt to re-initiate the connection
--gcs-project-for-requester-pays
Project to bill when accessing "requester pays" buckets. If unset, these buckets cannot be accessed. User must have storage.buckets.get permission on the bucket being accessed.
--help
 -h
false display the help message
--interval-merging-rule
 -imr
ALL Interval merging rule for abutting intervals
--intervals
 -L
One or more genomic intervals over which to operate
--min-alt-length
15 minimum length of supplemental alignment
--min-flanking-length
2 minimum number of wt calls flanking variant
--min-length
15 minimum size of high-quality portion of read
--min-mapq
4 minimum map quality for read alignment. reads having alignments with MAPQs less than this are treated as unmapped.
--min-q
30 minimum quality score for analyzed portion of read
--min-variant-obs
3 minimum number of observations of reported variants
--paired-mode
true paired mode evaluation of variants (combine mates, when possible)
--sites-only-vcf-output
false If true, don't emit genotype fields when writing vcf file output.
--version
false display the version number for this tool
--write-rejected-reads
false write BAM of rejected reads
Optional Common Arguments
--add-output-sam-program-record
true If true, adds a PG tag to created SAM/BAM/CRAM files.
--add-output-vcf-command-line
true If true, adds a command line header line to created VCF files.
--create-output-bam-index
 -OBI
true If true, create a BAM/CRAM index when writing a coordinate-sorted BAM/CRAM file.
--create-output-bam-md5
 -OBM
false If true, create a MD5 digest for any BAM/SAM/CRAM file created
--create-output-variant-index
 -OVI
true If true, create a VCF index when writing a coordinate-sorted VCF file.
--create-output-variant-md5
 -OVM
false If true, create a a MD5 digest any VCF file created.
--disable-read-filter
 -DF
Read filters to be disabled before analysis
--disable-tool-default-read-filters
false Disable all tool default read filters (WARNING: many tools will not function correctly without their default read filters on)
--exclude-intervals
 -XL
One or more genomic intervals to exclude from processing
--gatk-config-file
A configuration file to use with the GATK.
--interval-exclusion-padding
 -ixp
0 Amount of padding (in bp) to add to each interval you are excluding.
--interval-padding
 -ip
0 Amount of padding (in bp) to add to each interval you are including.
--interval-set-rule
 -isr
UNION Set merging approach to use for combining interval inputs
--inverted-read-filter
 -XRF
Inverted (with flipped acceptance/failure conditions) read filters applied before analysis (after regular read filters).
--lenient
 -LE
false Lenient processing of VCF files
--max-variants-per-shard
0 If non-zero, partitions VCF output into shards, each containing up to the given number of records.
--QUIET
false Whether to suppress job-summary info on System.err.
--read-filter
 -RF
Read filters to be applied before analysis
--read-index
Indices to use for the read inputs. If specified, an index must be provided for every read input and in the same order as the read inputs. If this argument is not specified, the path to the index for each input will be inferred automatically.
--read-validation-stringency
 -VS
SILENT Validation stringency for all SAM/BAM/CRAM/SRA files read by this program. The default stringency value SILENT can improve performance when processing a BAM file in which variable-length data (read, qualities, tags) do not otherwise need to be decoded.
--seconds-between-progress-updates
10.0 Output traversal statistics every time this many seconds elapse
--sequence-dictionary
Use the given sequence dictionary as the master/canonical sequence dictionary. Must be a .dict file.
--tmp-dir
Temp directory to use.
--use-jdk-deflater
 -jdk-deflater
false Whether to use the JdkDeflater (as opposed to IntelDeflater)
--use-jdk-inflater
 -jdk-inflater
false Whether to use the JdkInflater (as opposed to IntelInflater)
--verbosity
INFO Control verbosity of logging.
Advanced Arguments
--showHidden
false display hidden arguments

Argument details

Arguments in this list are specific to this tool. Keep in mind that other arguments are available that are shared with other tools (e.g. command-line GATK arguments); see Inherited arguments above.


--add-output-sam-program-record / -add-output-sam-program-record

If true, adds a PG tag to created SAM/BAM/CRAM files.

boolean  true


--add-output-vcf-command-line / -add-output-vcf-command-line

If true, adds a command line header line to created VCF files.

boolean  true


--arguments_file

read one or more arguments files and add them to the command line

List[File]  []


--cloud-index-prefetch-buffer / -CIPB

Size of the cloud-only prefetch buffer (in MB; 0 to disable). Defaults to cloudPrefetchBuffer if unset.

int  -1  [ [ -∞  ∞ ] ]


--cloud-prefetch-buffer / -CPB

Size of the cloud-only prefetch buffer (in MB; 0 to disable).

int  40  [ [ -∞  ∞ ] ]


--codon-translation

codon translation (a string of 64 amino acid codes

String  KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVVXYXYSSSSXCWCLFLF


--create-output-bam-index / -OBI

If true, create a BAM/CRAM index when writing a coordinate-sorted BAM/CRAM file.

boolean  true


--create-output-bam-md5 / -OBM

If true, create a MD5 digest for any BAM/SAM/CRAM file created

boolean  false


--create-output-variant-index / -OVI

If true, create a VCF index when writing a coordinate-sorted VCF file.

boolean  true


--create-output-variant-md5 / -OVM

If true, create a a MD5 digest any VCF file created.

boolean  false


--disable-bam-index-caching / -DBIC

If true, don't cache bam indexes, this will reduce memory requirements but may harm performance if many intervals are specified. Caching is automatically disabled if there are no intervals specified.

boolean  false


--disable-read-filter / -DF

Read filters to be disabled before analysis

List[String]  []


--disable-sequence-dictionary-validation / -disable-sequence-dictionary-validation

If specified, do not check the sequence dictionaries from our inputs for compatibility. Use at your own risk!

boolean  false


--disable-tool-default-read-filters / -disable-tool-default-read-filters

Disable all tool default read filters (WARNING: many tools will not function correctly without their default read filters on)

boolean  false


--dont-ignore-disjoint-pairs

don't discard disjoint mates (i.e., combine variants from both reads)

boolean  false


--exclude-intervals / -XL

One or more genomic intervals to exclude from processing
Use this argument to exclude certain parts of the genome from the analysis (like -L, but the opposite). This argument can be specified multiple times. You can use samtools-style intervals either explicitly on the command line (e.g. -XL 1 or -XL 1:100-200) or by loading in a file containing a list of intervals (e.g. -XL myFile.intervals). strings gathered from the command line -XL argument to be parsed into intervals to exclude

List[String]  []


--find-large-deletions

examine supplemental alignments to find large deletions

boolean  false


--gatk-config-file

A configuration file to use with the GATK.

String  null


--gcs-max-retries / -gcs-retries

If the GCS bucket channel errors out, how many times it will attempt to re-initiate the connection

int  20  [ [ -∞  ∞ ] ]


--gcs-project-for-requester-pays

Project to bill when accessing "requester pays" buckets. If unset, these buckets cannot be accessed. User must have storage.buckets.get permission on the bucket being accessed.

String  ""


--help / -h

display the help message

boolean  false


--input / -I

BAM/SAM/CRAM file containing reads

R List[GATKPath]  []


--interval-exclusion-padding / -ixp

Amount of padding (in bp) to add to each interval you are excluding.
Use this to add padding to the intervals specified using -XL. For example, '-XL 1:100' with a padding value of 20 would turn into '-XL 1:80-120'. This is typically used to add padding around targets when analyzing exomes.

int  0  [ [ -∞  ∞ ] ]


--interval-merging-rule / -imr

Interval merging rule for abutting intervals
By default, the program merges abutting intervals (i.e. intervals that are directly side-by-side but do not actually overlap) into a single continuous interval. However you can change this behavior if you want them to be treated as separate intervals instead.

The --interval-merging-rule argument is an enumerated type (IntervalMergingRule), which can have one of the following values:

ALL
OVERLAPPING_ONLY

IntervalMergingRule  ALL


--interval-padding / -ip

Amount of padding (in bp) to add to each interval you are including.
Use this to add padding to the intervals specified using -L. For example, '-L 1:100' with a padding value of 20 would turn into '-L 1:80-120'. This is typically used to add padding around targets when analyzing exomes.

int  0  [ [ -∞  ∞ ] ]


--interval-set-rule / -isr

Set merging approach to use for combining interval inputs
By default, the program will take the UNION of all intervals specified using -L and/or -XL. However, you can change this setting for -L, for example if you want to take the INTERSECTION of the sets instead. E.g. to perform the analysis only on chromosome 1 exomes, you could specify -L exomes.intervals -L 1 --interval-set-rule INTERSECTION. However, it is not possible to modify the merging approach for intervals passed using -XL (they will always be merged using UNION). Note that if you specify both -L and -XL, the -XL interval set will be subtracted from the -L interval set.

The --interval-set-rule argument is an enumerated type (IntervalSetRule), which can have one of the following values:

UNION
Take the union of all intervals
INTERSECTION
Take the intersection of intervals (the subset that overlaps all intervals specified)

IntervalSetRule  UNION


--intervals / -L

One or more genomic intervals over which to operate

List[String]  []


--inverted-read-filter / -XRF

Inverted (with flipped acceptance/failure conditions) read filters applied before analysis (after regular read filters).

List[String]  []


--lenient / -LE

Lenient processing of VCF files

boolean  false


--max-variants-per-shard

If non-zero, partitions VCF output into shards, each containing up to the given number of records.

int  0  [ [ 0  ∞ ] ]


--min-alt-length

minimum length of supplemental alignment

int  15  [ [ -∞  ∞ ] ]


--min-flanking-length

minimum number of wt calls flanking variant

int  2  [ [ -∞  ∞ ] ]


--min-length

minimum size of high-quality portion of read

int  15  [ [ -∞  ∞ ] ]


--min-mapq

minimum map quality for read alignment. reads having alignments with MAPQs less than this are treated as unmapped.

int  4  [ [ -∞  ∞ ] ]


--min-q

minimum quality score for analyzed portion of read

int  30  [ [ -∞  ∞ ] ]


--min-variant-obs

minimum number of observations of reported variants

long  3  [ [ -∞  ∞ ] ]


--orf

reference interval(s) of the ORF (1-based, inclusive), for example, '134-180,214-238' (no spaces)

R String  null


--output-file-prefix / -O

output file prefix

R String  null


--paired-mode

paired mode evaluation of variants (combine mates, when possible)

boolean  true


--QUIET

Whether to suppress job-summary info on System.err.

Boolean  false


--read-filter / -RF

Read filters to be applied before analysis

List[String]  []


--read-index / -read-index

Indices to use for the read inputs. If specified, an index must be provided for every read input and in the same order as the read inputs. If this argument is not specified, the path to the index for each input will be inferred automatically.

List[GATKPath]  []


--read-validation-stringency / -VS

Validation stringency for all SAM/BAM/CRAM/SRA files read by this program. The default stringency value SILENT can improve performance when processing a BAM file in which variable-length data (read, qualities, tags) do not otherwise need to be decoded.

The --read-validation-stringency argument is an enumerated type (ValidationStringency), which can have one of the following values:

STRICT
LENIENT
SILENT

ValidationStringency  SILENT


--reference / -R

Reference sequence file

R GATKPath  null


--seconds-between-progress-updates / -seconds-between-progress-updates

Output traversal statistics every time this many seconds elapse

double  10.0  [ [ -∞  ∞ ] ]


--sequence-dictionary / -sequence-dictionary

Use the given sequence dictionary as the master/canonical sequence dictionary. Must be a .dict file.

GATKPath  null


--showHidden / -showHidden

display hidden arguments

boolean  false


--sites-only-vcf-output

If true, don't emit genotype fields when writing vcf file output.

boolean  false


--tmp-dir

Temp directory to use.

GATKPath  null


--use-jdk-deflater / -jdk-deflater

Whether to use the JdkDeflater (as opposed to IntelDeflater)

boolean  false


--use-jdk-inflater / -jdk-inflater

Whether to use the JdkInflater (as opposed to IntelInflater)

boolean  false


--verbosity / -verbosity

Control verbosity of logging.

The --verbosity argument is an enumerated type (LogLevel), which can have one of the following values:

ERROR
WARNING
INFO
DEBUG

LogLevel  INFO


--version

display the version number for this tool

boolean  false


--write-rejected-reads

write BAM of rejected reads

boolean  false


Return to top


See also General Documentation | Tool Docs Index Tool Documentation Index | Support Forum

GATK version 4.6.2.0 built at Sun, 13 Apr 2025 13:21:43 -0400.